PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::G4SDH4 to PF06237 (DUF1011)

SwissProt::G4SDH4 has 476 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.1e-32   95.7  13.1    9.1e-32   95.7  13.1    2.9  3  SwissProt::G4SDH4  


Domain annotation for each sequence (and alignments):
>> SwissProt::G4SDH4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   0.7     0.081     0.081       6      24 ..     113     131 ..     109     166 .. 0.65
   2 ?   -2.3   0.2      0.33      0.33      58      71 ..     188     201 ..     178     211 .. 0.46
   3 !   95.7  13.1   9.1e-32   9.1e-32       4      99 .]     307     402 ..     305     402 .. 0.97

  Alignments for each domain:
  == domain 1  score: -0.4 bits;  conditional E-value: 0.081
            DUF1011   6 fllvllaivnaltnGvlps 24 
                         ll+ laivna++n ++ +
  SwissProt::G4SDH4 113 SLLFGLAIVNAMSNVLFMP 131
                        5777888888888876654 PP

  == domain 2  score: -2.3 bits;  conditional E-value: 0.33
            DUF1011  58 flpvrslkvlgvlt 71 
                        f+ + s++++++++
  SwissProt::G4SDH4 188 FFVIFSFTCVALFA 201
                        22222222222222 PP

  == domain 3  score: 95.7 bits;  conditional E-value: 9.1e-32
            DUF1011   4 lafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvg 95 
                        ++fll+++a+vna +nG+++svqsY++lpY++ +Yh++vtls++++Pl++fl +f++vrs+ vl++lt+++++++a+i++lA+lsP+ ++++
  SwissProt::G4SDH4 307 FTFLLFTTALVNAQMNGIITSVQSYAALPYSQATYHFAVTLSNVVSPLSSFLPFFISVRSIPVLAILTACSTAMTAFIVYLAALSPNLIFNS 398
                        689**************************************************************************************999 PP

            DUF1011  96 stlG 99 
                         t+G
  SwissProt::G4SDH4 399 VTIG 402
                        8876 PP



Or compare SwissProt::G4SDH4 to CDD or PaperBLAST