PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q4FZU9 to PF06237 (DUF1011)

SwissProt::Q4FZU9 has 463 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.2e-44  134.2   7.2    9.2e-44  134.2   7.2    3.1  4  SwissProt::Q4FZU9  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q4FZU9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   0.3     0.097     0.097      50      87 ..      55      92 ..      42     104 .. 0.54
   2 ?   -2.0   1.4      0.25      0.25      71      71 ..     104     104 ..      74     141 .. 0.52
   3 ?   -3.8   0.2      0.95      0.95      68      80 ..     220     232 ..     211     236 .. 0.49
   4 !  134.2   7.2   9.2e-44   9.2e-44       3      98 ..     293     388 ..     291     389 .. 0.97

  Alignments for each domain:
  == domain 1  score: -0.6 bits;  conditional E-value: 0.097
            DUF1011 50 PlacflamflpvrslkvlgvltllglllsaYilalAvl 87
                       Pl ++l+  ++   l+ + v++l+ ++ ++ +++lA+l
  SwissProt::Q4FZU9 55 PLLVTLMHRFRPGCLSEVPVIFLILCVGTTACILLAFL 92
                       55555555555555555555555555555555555544 PP

  == domain 2  score: -2.0 bits;  conditional E-value: 0.25
            DUF1011  71 t 71 
                         
  SwissProt::Q4FZU9 104 H 104
                        2 PP

  == domain 3  score: -3.8 bits;  conditional E-value: 0.95
            DUF1011  68 gvltllglllsaY 80 
                         + +l+g++l a+
  SwissProt::Q4FZU9 220 LLSFLMGCCLVAF 232
                        3333344444444 PP

  == domain 4  score: 134.2 bits;  conditional E-value: 9.2e-44
            DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLv 94 
                        qlaf+++++a+vnaltnGvlpsvq+YsclpYG +aYhls+tlss+a+Placfl +flp+rsl +lgvlt+lg+ +++Y++a+A++sP+p+L+
  SwissProt::Q4FZU9 293 QLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGTYNMAMAAMSPCPILQ 384
                        899***************************************************************************************** PP

            DUF1011  95 gstl 98 
                        g++ 
  SwissProt::Q4FZU9 385 GHWG 388
                        9875 PP



Or compare SwissProt::Q4FZU9 to CDD or PaperBLAST