PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q863Y7 to PF06237 (DUF1011)

SwissProt::Q863Y7 has 446 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.3e-38  117.7   5.6    1.3e-38  117.7   5.6    2.7  2  SwissProt::Q863Y7  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q863Y7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   1.4     0.026     0.026      40      81 ..      87     129 ..      82     146 .. 0.65
   2 !  117.7   5.6   1.3e-38   1.3e-38       4      99 .]     277     372 ..     274     372 .. 0.97

  Alignments for each domain:
  == domain 1  score: 1.2 bits;  conditional E-value: 0.026
            DUF1011  40 lsvtlssianPlacfla.mflpvrslkvlgvltllglllsaYi 81 
                        lsv+ +++  Pl   l+ m  +v+s+++l+++++l+l+++a +
  SwissProt::Q863Y7  87 LSVVGTALLAPLWQHLTvMAGQVHSVAFLALTFVLALACCASN 129
                        6666677777777666514456689999998888887766543 PP

  == domain 2  score: 117.7 bits;  conditional E-value: 1.3e-38
            DUF1011   4 lafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvg 95 
                         a+ll lla ++altnGvlp+vqsYs+lpYG+ aYhl+v+l+s +nPlacflam + +rsl+ lg l+llg+l++aY++alA+lsP+ppLvg
  SwissProt::Q863Y7 277 GACLLGLLATTSALTNGVLPAVQSYSSLPYGRLAYHLAVVLGSASNPLACFLAMGILCRSLAGLGGLSLLGTLFGAYLMALAILSPCPPLVG 368
                        6789**************************************************************************************** PP

            DUF1011  96 stlG 99 
                        +++G
  SwissProt::Q863Y7 369 TSAG 372
                        9987 PP



Or compare SwissProt::Q863Y7 to CDD or PaperBLAST