PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q863Y8 to PF06237 (DUF1011)

SwissProt::Q863Y8 has 448 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.3e-40  122.7   7.3    3.3e-40  122.7   7.3    2.6  3  SwissProt::Q863Y8  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q863Y8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   0.7     0.098     0.098      42      79 ..      89     127 ..      82     145 .. 0.57
   2 !  122.7   7.3   3.3e-40   3.3e-40       4      99 .]     279     374 ..     276     374 .. 0.98
   3 ?   -3.5   0.7      0.76      0.76      67      83 ..     378     394 ..     375     398 .. 0.45

  Alignments for each domain:
  == domain 1  score: -0.6 bits;  conditional E-value: 0.098
            DUF1011  42 vtlssianPlacflamflpv.rslkvlgvltllglllsa 79 
                        v+ +++  Pl   +a +  + +s+++l++ ++l+l++++
  SwissProt::Q863Y8  89 VVGTALLAPLWHHVAPVAGQlHSVAFLTLALVLALACCT 127
                        555555566665555554333666666666555554443 PP

  == domain 2  score: 122.7 bits;  conditional E-value: 3.3e-40
            DUF1011   4 lafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvg 95 
                         afll llai++altnGvlp+vqs+sclpYG+ aYhl+v+l+s anPlacflam + +rsl+ l+ l+llg+l++aY+++lA+lsP+ppLvg
  SwissProt::Q863Y8 279 GAFLLGLLAITSALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMVLAILSPCPPLVG 370
                        689***************************************************************************************** PP

            DUF1011  96 stlG 99 
                        +t+G
  SwissProt::Q863Y8 371 TTAG 374
                        *987 PP

  == domain 3  score: -3.5 bits;  conditional E-value: 0.76
            DUF1011  67 lgvltllglllsaYila 83 
                        +++  +l+l++ +Y+ +
  SwissProt::Q863Y8 378 VVLSWVLCLCVFSYVKV 394
                        33344444455555544 PP



Or compare SwissProt::Q863Y8 to CDD or PaperBLAST