PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9HAB3 to PF06237 (DUF1011)

SwissProt::Q9HAB3 has 445 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.1e-39  121.1   5.4    1.1e-39  121.1   5.4    2.5  2  SwissProt::Q9HAB3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9HAB3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.8   0.4      0.11      0.11      69      88 ..     108     127 ..      85     139 .. 0.66
   2 !  121.1   5.4   1.1e-39   1.1e-39       3      99 .]     275     371 ..     273     371 .. 0.97

  Alignments for each domain:
  == domain 1  score: -0.8 bits;  conditional E-value: 0.11
            DUF1011  69 vltllglllsaYilalAvls 88 
                         l  +++l+ a++lalA+  
  SwissProt::Q9HAB3 108 QLHSVAFLALAFVLALACCA 127
                        44555555566666666544 PP

  == domain 2  score: 121.1 bits;  conditional E-value: 1.1e-39
            DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLv 94 
                        + a+ll lla++naltnGvlp+vqs+sclpYG+ aYhl+v+l+s anPlacflam + +rsl+ lg l+llg+++++Y++alAvlsP+ppLv
  SwissProt::Q9HAB3 275 RSACLLGLLAATNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCGGYLMALAVLSPCPPLV 366
                        67899*************************************************************************************** PP

            DUF1011  95 gstlG 99 
                        g+++G
  SwissProt::Q9HAB3 367 GTSAG 371
                        *9987 PP



Or compare SwissProt::Q9HAB3 to CDD or PaperBLAST