PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002925444.1 to PF06237 (DUF1011)

XP_002925444.1 has 469 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.5e-44  136.0   9.0    2.5e-44  136.0   9.0    3.2  4  XP_002925444.1  


Domain annotation for each sequence (and alignments):
>> XP_002925444.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.9   0.2      0.12      0.12      43      80 ..      49      88 ..      43      98 .. 0.59
   2 ?   -0.5   1.5     0.091     0.091      49      84 ..      82     118 ..      74     131 .. 0.58
   3 ?   -2.8   0.4      0.46      0.46      51      55 ..     231     235 ..     218     243 .. 0.45
   4 !  136.0   9.0   2.5e-44   2.5e-44       3      99 .]     299     395 ..     297     395 .. 0.98

  Alignments for each domain:
  == domain 1  score: -0.9 bits;  conditional E-value: 0.12
         DUF1011 43 tlssianPlacflamflpv..rslkvlgvltllglllsaY 80
                    +l++i   l+++l  f p+   ++ ++++++++g++++a 
  XP_002925444.1 49 QLANIGPLLVTLLHHFQPSclSEVPIIFTVLAVGTVACAL 88
                    5666655566666666666445566666666666665543 PP

  == domain 2  score: -0.5 bits;  conditional E-value: 0.091
         DUF1011  49 nPlacflamflpvrslkvlgv.ltllglllsaYilal 84 
                       +ac l+ fl +   +vl    ++++++l+ ++ ++
  XP_002925444.1  82 GTVACALFAFLWNVTSWVLDGrHSIAFMVLTFFLALV 118
                     5678877777666555555440444444444444444 PP

  == domain 3  score: -2.8 bits;  conditional E-value: 0.46
         DUF1011  51 lacfl 55 
                     +ac+l
  XP_002925444.1 231 MACCL 235
                     22222 PP

  == domain 4  score: 136.0 bits;  conditional E-value: 2.5e-44
         DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgst 97 
                     +laf++vl+a+vnaltnGvlpsvq+Yscl+YG +aYhls+tlss+anPlacfl+mflp+rsl +lgvlt+lg+ ++aY++a+Av+sP+p+++g++
  XP_002925444.1 299 HLAFIYVLVAFVNALTNGVLPSVQTYSCLSYGPVAYHLSATLSSMANPLACFLSMFLPHRSLPFLGVLTVLGTGFGAYNMAMAVMSPCPLMQGHW 393
                     689******************************************************************************************99 PP

         DUF1011  98 lG 99 
                     +G
  XP_002925444.1 394 AG 395
                     87 PP



Or compare XP_002925444.1 to CDD or PaperBLAST