PaperBLAST – Find papers about a protein or its homologs

 

Align XP_005260712.1 to PF06237 (DUF1011)

XP_005260712.1 has 469 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.9e-41  125.7   8.4    3.9e-41  125.7   8.4    3.1  4  XP_005260712.1  


Domain annotation for each sequence (and alignments):
>> XP_005260712.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.0   0.1      0.12      0.12      43      79 ..      49      87 ..      43     104 .. 0.54
   2 ?   -0.4   1.0     0.081     0.081      51      84 ..      84     118 ..      74     133 .. 0.59
   3 ?   -1.5   0.1      0.18      0.18      76      78 ..     231     233 ..     196     245 .. 0.56
   4 !  125.7   8.4   3.9e-41   3.9e-41       3      98 ..     299     394 ..     297     395 .. 0.97

  Alignments for each domain:
  == domain 1  score: -1.0 bits;  conditional E-value: 0.12
         DUF1011 43 tlssianPlacflamflpv..rslkvlgvltllglllsa 79
                    +l++i   l+++l  f p+   ++ ++++l+ +g++++ 
  XP_005260712.1 49 QLANIGPLLVTLLHHFRPSclSEVPIIFTLLGVGTVTCI 87
                    556665556666666666633333344444333333332 PP

  == domain 2  score: -0.4 bits;  conditional E-value: 0.081
         DUF1011  51 lacflamflpvrslkvl.gvltllglllsaYilal 84 
                     ++c+++ fl +   +vl g  ++++l+l+ ++ ++
  XP_005260712.1  84 VTCIIFAFLWNMTSWVLdGHHSIAFLVLTFFLALV 118
                     66777666665555555044455555555554444 PP

  == domain 3  score: -1.5 bits;  conditional E-value: 0.18
         DUF1011  76 lls 78 
                     +++
  XP_005260712.1 231 MAC 233
                     111 PP

  == domain 4  score: 125.7 bits;  conditional E-value: 3.9e-41
         DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgst 97 
                     +laf+++l+a+vnaltnG+lpsvq+Yscl+YG +aYhl++tls +anPla++++mflp+rsl +lgvl++lg+++++Y++a+Av+sP+p+L+g++
  XP_005260712.1 299 HLAFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHW 393
                     689*****************************************************************************************987 PP

         DUF1011  98 l 98 
                      
  XP_005260712.1 394 G 394
                     5 PP



Or compare XP_005260712.1 to CDD or PaperBLAST