PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006241888.1 to PF06237 (DUF1011)

XP_006241888.1 has 450 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-39  121.0   8.2    1.2e-39  121.0   8.2    2.4  2  XP_006241888.1  


Domain annotation for each sequence (and alignments):
>> XP_006241888.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.8   0.4      0.11      0.11      55      79 ..     102     127 ..      86     144 .. 0.56
   2 !  121.0   8.2   1.2e-39   1.2e-39       3      99 .]     280     376 ..     278     376 .. 0.97

  Alignments for each domain:
  == domain 1  score: -0.8 bits;  conditional E-value: 0.11
         DUF1011  55 lamflpv.rslkvlgvltllglllsa 79 
                     +a++  + +s+++l++ ++l+l ++a
  XP_006241888.1 102 MALVAGQlHSVAFLTLAFVLALSCCA 127
                     44444332555555555555444433 PP

  == domain 2  score: 121.0 bits;  conditional E-value: 1.2e-39
         DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgst 97 
                     + a+ll llai+naltnGvlp+vqs+sclpYG+ aYhl+v+l+s anPlacflam + +rsl+ l+ l+llg+++++Y+++lAvlsP+ppLvg++
  XP_006241888.1 280 RSACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSSANPLACFLAMAVLCRSLAGLYGLCLLGMFFGTYLMTLAVLSPCPPLVGTS 374
                     6789*****************************************************************************************99 PP

         DUF1011  98 lG 99 
                     +G
  XP_006241888.1 375 AG 376
                     87 PP



Or compare XP_006241888.1 to CDD or PaperBLAST