PaperBLAST – Find papers about a protein or its homologs

 

Align XP_008760550.1 to PF06237 (DUF1011)

XP_008760550.1 has 463 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.2e-44  134.2   7.2    9.2e-44  134.2   7.2    3.2  4  XP_008760550.1  


Domain annotation for each sequence (and alignments):
>> XP_008760550.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   0.3      0.07      0.07      46      87 ..      52      92 ..      42     105 .. 0.49
   2 ?   -1.8   1.2      0.22      0.22      71      71 ..     104     104 ..      74     141 .. 0.52
   3 ?   -3.8   0.2      0.95      0.95      68      80 ..     220     232 ..     211     236 .. 0.49
   4 !  134.2   7.2   9.2e-44   9.2e-44       3      98 ..     293     388 ..     291     389 .. 0.97

  Alignments for each domain:
  == domain 1  score: -0.2 bits;  conditional E-value: 0.07
         DUF1011 46 sianPlacflamflpvrslkvlgvltllglllsaYilalAvl 87
                    +i  Pl ++l+  ++   l+ + v++l+ ++ ++ +++lA+l
  XP_008760550.1 52 NIG-PLLVTLMHRFRPGCLSEVPVIFLILCVGTTACILLAFL 92
                    443.44444444444444444444444444444445555543 PP

  == domain 2  score: -1.8 bits;  conditional E-value: 0.22
         DUF1011  71 t 71 
                      
  XP_008760550.1 104 H 104
                     2 PP

  == domain 3  score: -3.8 bits;  conditional E-value: 0.95
         DUF1011  68 gvltllglllsaY 80 
                      + +l+g++l a+
  XP_008760550.1 220 LLSFLMGCCLVAF 232
                     3333344444444 PP

  == domain 4  score: 134.2 bits;  conditional E-value: 9.2e-44
         DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgst 97 
                     qlaf+++++a+vnaltnGvlpsvq+YsclpYG +aYhls+tlss+a+Placfl +flp+rsl +lgvlt+lg+ +++Y++a+A++sP+p+L+g++
  XP_008760550.1 293 QLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGTYNMAMAAMSPCPILQGHW 387
                     899*****************************************************************************************987 PP

         DUF1011  98 l 98 
                      
  XP_008760550.1 388 G 388
                     5 PP



Or compare XP_008760550.1 to CDD or PaperBLAST