PaperBLAST – Find papers about a protein or its homologs

 

Align XP_011522253.1 to PF06237 (DUF1011)

XP_011522253.1 has 448 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.6e-40  122.0   7.5    5.6e-40  122.0   7.5    2.7  3  XP_011522253.1  


Domain annotation for each sequence (and alignments):
>> XP_011522253.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.3   0.8     0.075     0.075      46      79 ..      93     127 ..      82     146 .. 0.53
   2 !  122.0   7.5   5.6e-40   5.6e-40       4      99 .]     279     374 ..     276     374 .. 0.98
   3 ?   -3.5   0.7      0.76      0.76      67      83 ..     378     394 ..     375     398 .. 0.45

  Alignments for each domain:
  == domain 1  score: -0.3 bits;  conditional E-value: 0.075
         DUF1011  46 sianPlacflamflpv.rslkvlgvltllglllsa 79 
                     ++  Pl   +a +  + +s+++l++ ++l++++++
  XP_011522253.1  93 ALLAPLWHHVAPVAGQlHSVAFLTLALVLAMACCT 127
                     55555555555444332555555555554444333 PP

  == domain 2  score: 122.0 bits;  conditional E-value: 5.6e-40
         DUF1011   4 lafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgstl 98 
                      afll l+a+++a+tnGvlpsvqs+sclpYG+ aYhl+v+l+s anPlacflam + +rsl+ l+ l+llg+l++aY++alA+lsP+ppLvg+t+
  XP_011522253.1 279 GAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTA 373
                     689******************************************************************************************98 PP

         DUF1011  99 G 99 
                     G
  XP_011522253.1 374 G 374
                     7 PP

  == domain 3  score: -3.5 bits;  conditional E-value: 0.76
         DUF1011  67 lgvltllglllsaYila 83 
                     +++  +l+l++ +Y+ +
  XP_011522253.1 378 VVLSWVLCLCVFSYVKV 394
                     33344444455555544 PP



Or compare XP_011522253.1 to CDD or PaperBLAST