PaperBLAST – Find papers about a protein or its homologs

 

Align XP_016869311.1 to PF06237 (DUF1011)

XP_016869311.1 has 281 amino acids

Query:       DUF1011  [M=99]
Accession:   PF06237.12
Description: Protein of unknown function (DUF1011)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.6e-40  122.3   5.4    4.6e-40  122.3   5.4    1.8  2  XP_016869311.1  


Domain annotation for each sequence (and alignments):
>> XP_016869311.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  122.3   5.4   4.6e-40   4.6e-40       3      99 .]     111     207 ..     109     207 .. 0.97
   2 ?   -2.9   0.4      0.49      0.49      67      81 ..     211     225 ..     208     231 .. 0.44

  Alignments for each domain:
  == domain 1  score: 122.3 bits;  conditional E-value: 4.6e-40
         DUF1011   3 qlafllvllaivnaltnGvlpsvqsYsclpYGnkaYhlsvtlssianPlacflamflpvrslkvlgvltllglllsaYilalAvlsPtppLvgst 97 
                     + a+ll lla++naltnGvlp+vqs+sclpYG+ aYhl+v+l+s anPlacflam + +rsl+ lg l+llg+++++Y++alAvlsP+ppLvg++
  XP_016869311.1 111 RSACLLGLLAATNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCGGYLMALAVLSPCPPLVGTS 205
                     6789*****************************************************************************************99 PP

         DUF1011  98 lG 99 
                     +G
  XP_016869311.1 206 AG 207
                     87 PP

  == domain 2  score: -2.9 bits;  conditional E-value: 0.49
         DUF1011  67 lgvltllglllsaYi 81 
                     +++  +l+l + +Y+
  XP_016869311.1 211 VVLSWVLCLGVFSYV 225
                     333334444445554 PP



Or compare XP_016869311.1 to CDD or PaperBLAST