XP_002900425.1 has 1346 amino acids
Query: THH1_TOM1-3_dom [M=273] Accession: PF06454.15 Description: THH1/TOM1/TOM3 domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-11 28.1 3.1 1.4e-10 27.1 3.1 1.4 1 XP_002900425.1 Domain annotation for each sequence (and alignments): >> XP_002900425.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.1 3.1 1.4e-10 1.4e-10 69 262 .. 59 278 .. 45 288 .. 0.80 Alignments for each domain: == domain 1 score: 27.1 bits; conditional E-value: 1.4e-10 THH1_TOM1-3_dom 69 vvfvfrravqslepevlqlvlldlpgllffttytllvlfWaeiyyqarslstdklrpafllingviyviqillWllllvkpn............ 150 v+f+++ra + +++ + + +l + lff+ + l+W++i s ++ ++ +af+++ng y+ + l ++ +k XP_002900425.1 59 VLFAVTRAASFVSEGLARNLLNRAALCLFFSLVLFQTLLWIDIANPKVSTRSRRIWIAFVVANGLFYAAVLGLSVMHEAKVAqarhsksrlnrs 152 6799999999999999999999999999*****9**********************************99999888776655455666666654 PP THH1_TOM1-3_dom 151 .ellevlsklffaavsllaalgfllyGgrlflmlkrfPies.kGrr........kklrevglvtai....Cflcflirsvlvalsafdkkadld 230 + vl lf+a+ s++++lg+++ ++ ++r s G r kkl+ +t++ C + f +r+++ + f ++ d XP_002900425.1 153 tLWTGVLPVLFIATGSFVSSLGLVYSTWKMRHRVERVLKPSgNGLRrrlderveKKLTSALRFTSVvmgaCSVLFFLRTIIYVQRPFSHQGCGD 246 2233456779**************99999999999975444245441122222255555444444333339999*************9999999 PP THH1_TOM1-3_dom 231 vldhPilnliyyllveilPsalvlfilrklPp 262 + + + ++ y++ ei+P +l l+++ + p XP_002900425.1 247 IHSPDVCVVVGYVIPEIVPCVLFLVLMWEVEP 278 9999999999**************99987766 PP
Or compare XP_002900425.1 to CDD or PaperBLAST