SwissProt::A0A481WQ01 has 308 amino acids
Query: FrsA-like [M=414] Accession: PF06500.15 Description: Esterase FrsA-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-10 24.2 0.0 1e-09 23.7 0.0 1.2 1 SwissProt::A0A481WQ01 Domain annotation for each sequence (and alignments): >> SwissProt::A0A481WQ01 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.7 0.0 1e-09 1e-09 170 302 .. 6 143 .. 3 165 .. 0.82 Alignments for each domain: == domain 1 score: 23.7 bits; conditional E-value: 1e-09 FrsA-like 170 qlefsvqdgkkiagflhlpk..tdaplpvvlvsaGldslqtdyyrlfrdylapkdiamltidlpsvGasskwklte.dssll...hqa 251 ++ef+ dg ++ g l + + ++ +v+++ +q + + y+++++i+ lt d s G s + e d s + + SwissProt::A0A481WQ01 6 KVEFQTLDGLTLRGRLFRAEgaGGNRTAAVVITPPYVIVQDVMVSDIAVYFSQQGITALTYDTRSFGESDGQPRCElDLSKQvddYSD 93 67888888888888888777334556777888888999999999999**********************8776655365554112456 PP FrsA-like 252 vlkaladvpwvdhtrvalvGfrfGanvavrlaylesekvkavvalGavvhd 302 + la++p vd +++ G f a va a l+ + + v+++G++v+ SwissProt::A0A481WQ01 94 AFTFLASLPSVDPSKIGFWGISFCATVALNAAALDR-RSRFVISVGPIVKA 143 7889****************************9975.789********975 PP
Or compare SwissProt::A0A481WQ01 to CDD or PaperBLAST