PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P04335 to PF06500 (DUF1100)

SwissProt::P04335 has 414 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   7.9e-227  738.8   0.0   8.8e-227  738.6   0.0    1.0  1  SwissProt::P04335  


Domain annotation for each sequence (and alignments):
>> SwissProt::P04335  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  738.6   0.0  8.8e-227  8.8e-227       1     411 []       1     414 []       1     414 [] 0.99

  Alignments for each domain:
  == domain 1  score: 738.6 bits;  conditional E-value: 8.8e-227
            DUF1100   1 avsknlsetlfkkkkkaketsalvrrlptsk..elldaldektakawyrnlrrlqwiwrGvdpleieevlariasskaertddelldtvvGy 90 
                        ++++nlsetlfk+++k++ets+lvrr+++++  ++++ald+kt+ +wyr+++rl+wiwrG+dp+ei +v+ari++s+aertdd+l+dtv+Gy
  SwissProt::P04335   1 MTQANLSETLFKPRFKHPETSTLVRRFNHGAqpPVQSALDGKTIPHWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGY 92 
                        789**************************99889********************************************************** PP

            DUF1100  91 rsGnwiyewaklgmlhqkkaaeekde.eaaeellaaallysiagyphlkgdnlalqaqvlanrayeeaakklkyvlkqlelpvek.kkitgf 180
                        r+Gnwiyewa+++m++q+ka++e+d+  +++++l+aa+ly+ia+yphlkgd+la+qaq+l+nrayeeaa++l+ +++q+e++v++ ++itgf
  SwissProt::P04335  93 RGGNWIYEWATQAMVWQQKACAEDDPqLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQRLPGTMRQMEFTVPGgAPITGF 184
                        **************************89********************************************************999***** PP

            DUF1100 181 lhlpktdkplpvvlvsaGldslqtdmyrlfrdylakkdiamltidlpsvGasskwkltedssllhqavlkeladvpyvdhtrvgliGfrfGa 272
                        lh+pk+d+p+p+vl+++Gld++qtd+y+l+++y+a+++iamltid+psvG+sskwklt+dssllhq+vlk+l +vp+vdhtrv+++GfrfGa
  SwissProt::P04335 185 LHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGA 276
                        ******************************************************************************************** PP

            DUF1100 273 nvavrlaflesekvkavvalGavvhdlltsskklqkvpkmyldvlasrlGksdvdieslsgelnayslkvqGllsgrrtktpilalslegdp 364
                        nvavrla+les+++kav++lG+vvh+ll+++k++q+vp+myldvlasrlG++d+++e+l++eln+yslkvqGll grr++tp+l++++++dp
  SwissProt::P04335 277 NVAVRLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLL-GRRCPTPMLSGYWKNDP 367
                        **************************************************************************.***************** PP

            DUF1100 365 vspkednklvalfsadGklkkissktitkgyeksldlaiewledell 411
                        +sp+ed++l++++sadGkl++i++++++++++k+l+++++w+e++l+
  SwissProt::P04335 368 FSPEEDSRLITSSSADGKLLEIPFNPVYRNFDKGLQEITDWIEKRLC 414
                        *********************************************98 PP



Or compare SwissProt::P04335 to CDD or PaperBLAST