PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q93NG6 to PF06500 (DUF1100)

SwissProt::Q93NG6 has 367 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    5.7e-17   47.6   0.0    9.5e-17   46.9   0.0    1.2  1  SwissProt::Q93NG6  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q93NG6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   46.9   0.0   9.5e-17   9.5e-17      95     293 ..      41     240 ..      29     245 .. 0.90

  Alignments for each domain:
  == domain 1  score: 46.9 bits;  conditional E-value: 9.5e-17
            DUF1100  95 wiyewaklgmlhqkkaaee....kdeeaaeellaaallysiagyphlkgdnlalqaqvlanrayeeaakklkyvlkqlelpvekkkitgflh 182
                        w   w+ l+ ++ ++a  +    +d +a+e l++aal+ + a +  l  d+  ++ q+   + y++aa  l+    + el v++ ++  ++ 
  SwissProt::Q93NG6  41 WFDYWMSLANEYEQEAERKvalgHDLSAGELLMSAALCAQYAQF--LWFDERRQKGQARKVELYQKAAPLLSPPAERHELVVDGIPMPVYVR 130
                        77789999999999887652222455999*********999987..677899999999999******************************* PP

            DUF1100 183 lpktdkplpvvlvsaGldslqtdmyrlfrdylakkdiamltidlpsvGasskwk.ltedssllhqavlkeladvpyvdhtrvgliGfrfGan 273
                        +p++ +p+p v++ +Gl+s + + +++ ++ +  +++a  t d p  G   ++k ++ d+     av++ l+++  +    +g++G  +G+n
  SwissProt::Q93NG6 131 IPEGPGPHPAVIMLGGLESTKEESFQM-ENLVLDRGMATATFDGPGQGEMFEYKrIAGDYEKYTSAVVDLLTKLEAIRNDAIGVLGRSLGGN 221
                        *************************97.788889*****************9974789********************************** PP

            DUF1100 274 vavrlaflesekvkavvalG 293
                         a + a  e +++ a+++ G
  SwissProt::Q93NG6 222 YALKSAACE-PRLAACISWG 240
                        ***999887.5899999887 PP



Or compare SwissProt::Q93NG6 to CDD or PaperBLAST