PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS537693 to PF06500 (DUF1100)

VIMSS537693 has 368 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.7e-23   67.6   0.0    5.5e-23   67.4   0.0    1.0  1  VIMSS537693  


Domain annotation for each sequence (and alignments):
>> VIMSS537693  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.4   0.0   5.5e-23   5.5e-23      89     374 ..      32     321 ..      19     357 .. 0.80

  Alignments for each domain:
  == domain 1  score: 67.4 bits;  conditional E-value: 5.5e-23
      DUF1100  89 GyrsGnwiyewaklgmlhqkkaaeekde....eaaeellaaallysiagyphlkgdnlalqaqvlanrayeeaakklkyvlkqlelpvek.....kki 177
                   y    w+  +  ++  +q +a e ++      a e++l a  +y +a yp +++    + a   + +    a+++ +  + ++e+p+ +      +i
  VIMSS537693  32 SYDRDAWAAAFSAVAARYQARAEEAEQIgdtsVAHENYLRAYGYYRMARYPTMNSAG-KKSAYRKSQEMLLRASRYFDIPIERVEIPFAGrpgegDRI 128
                  688889999*************987642212467899***************98765.567888999********************9752222368* PP

      DUF1100 178 tgflhlpktdkplpvvlvsaGldslqtdmyrlfrdylakkdiamltidlpsvGasskwkltedssllhqavlkeladvpyvdhtrvgliGfrfGanva 275
                  +++l +pk+ + lpv+lvs+G+d+++ dm+    d +  +++a l+id+p vG +     +ed+ ++   vl+ +a  p +d   vg  G   G+  a
  VIMSS537693 129 IAHLRVPKATDRLPVLLVSGGIDTFKEDMHT---DQVLARNVATLAIDIPGVGDAP-LAGSEDAERMFTPVLEWIAGRPELDPAGVGYWGGSTGGYWA 222
                  *****************************85...888999*************864.6779************************************* PP

      DUF1100 276 vrlaflesekvkavvalGavvhdlltsskklqkvpkmyldvlasrlGksdv..dieslsgelnayslkvqGllsgrrtktpilalslegdpvspkedn 371
                  +++a+  ++ +  vv+ G  + + +      q+    y   la  l  +    + e       + sl  qG+l  r +   +l   l+ d v p +d 
  VIMSS537693 223 AKIAHTHRNSLACVVSQGGCIDHGFDAEWIEQAQSGEYPFELAETLAYAFGrdTFEQWVDYAPKLSLVRQGIL-DRPCAETLLINGLH-DTVFPISDY 318
                  *******************998888666555555555544455555444330023444455668899999999.89998888888775.677788877 PP

      DUF1100 372 klv 374
                   l+
  VIMSS537693 319 YLL 321
                  665 PP



Or compare VIMSS537693 to CDD or PaperBLAST