PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS54863 to PF06500 (DUF1100)

VIMSS54863 has 415 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   5.7e-239  778.8   1.2   6.6e-239  778.6   1.2    1.0  1  VIMSS54863  


Domain annotation for each sequence (and alignments):
>> VIMSS54863  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  778.6   1.2  6.6e-239  6.6e-239       2     411 .]       5     414 ..       4     414 .. 1.00

  Alignments for each domain:
  == domain 1  score: 778.6 bits;  conditional E-value: 6.6e-239
     DUF1100   2 vsknlsetlfkkkkkaketsalvrrlptskelldaldektakawyrnlrrlqwiwrGvdpleieevlariasskaertddelldtvvGyrsGnwiyewa 100
                 +sknlsetlf+++k+akets+l++++p+s elld+++e++++awyrnlrrlqwiw+Gvdp+e+ee+lariassk++rt+de+ldtv+GyrsGnw+yew+
  VIMSS54863   5 SSKNLSETLFQNHKQAKETSSLTQYMPSSLELLDTRREQSSQAWYRNLRRLQWIWQGVDPVEQEEILARIASSKHSRTHDEWLDTVMGYRSGNWTYEWT 103
                 79************************************************************************************************* PP

     DUF1100 101 klgmlhqkkaaeekdeeaaeellaaallysiagyphlkgdnlalqaqvlanrayeeaakklkyvlkqlelpvekkkitgflhlpktdkplpvvlvsaGl 199
                 ++gmlhqk+aae+++eeaa++++aaal+ysiagyphl++dnlalqaqvlan+ay+eaak + +v+k+le+++++kki+g+lhl++td+p+pvvlvsaGl
  VIMSS54863 104 RVGMLHQKQAAERQGEEAADQMFAAALYYSIAGYPHLRNDNLALQAQVLANNAYQEAAKLTGFVVKRLEFSYQNKKIAGYLHLRNTDSPKPVVLVSAGL 202
                 *************************************************************************************************** PP

     DUF1100 200 dslqtdmyrlfrdylakkdiamltidlpsvGasskwkltedssllhqavlkeladvpyvdhtrvgliGfrfGanvavrlaflesekvkavvalGavvhd 298
                 dslqtdm+rlfrdylak+diamltid+ps+Gass+w+ltedss+lhqavl++lad+p+vdh+r+gliGfrfG+n+++rlafles+kvka+v+lGa++hd
  VIMSS54863 203 DSLQTDMWRLFRDYLAKRDIAMLTIDMPSLGASSHWPLTEDSSCLHQAVLNQLADLPWVDHFRIGLIGFRFGGNAMARLAFLESDKVKACVSLGAPIHD 301
                 *************************************************************************************************** PP

     DUF1100 299 lltsskklqkvpkmyldvlasrlGksdvdieslsgelnayslkvqGllsgrrtktpilalslegdpvspkednklvalfsadGklkkissktitkgyek 397
                 ++ts++kl+++pkmyldvlasrlGk++vd++slsg+l+a+slkvqG++sgrrtktpilal legdpvsp++dn+lvalfs+ G++kk++skti++gye+
  VIMSS54863 302 IFTSPNKLAAMPKMYLDVLASRLGKNVVDVRSLSGQLMAWSLKVQGFMSGRRTKTPILALGLEGDPVSPYSDNQLVALFSQGGQAKKVKSKTISQGYEQ 400
                 *************************************************************************************************** PP

     DUF1100 398 sldlaiewledell 411
                 sldlai+wledel+
  VIMSS54863 401 SLDLAINWLEDELC 414
                 ************98 PP



Or compare VIMSS54863 to CDD or PaperBLAST