PaperBLAST – Find papers about a protein or its homologs

 

Align WP_010892120.1 to PF06500 (DUF1100)

WP_010892120.1 has 316 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.2e-11   29.2   0.0    3.1e-11   28.7   0.0    1.1  1  WP_010892120.1  


Domain annotation for each sequence (and alignments):
>> WP_010892120.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.7   0.0   3.1e-11   3.1e-11     167     285 ..      51     179 ..      40     199 .. 0.79

  Alignments for each domain:
  == domain 1  score: 28.7 bits;  conditional E-value: 3.1e-11
         DUF1100 167 qlelpvekkkitgflhlpktdkp...lpvvlvsaGldslq....tdmyrlfrdylakkdiamltidlpsvGasskwkl...tedssllhqavlke 251
                      +++  ++++++g lhlp+t +p   +p+v++  G+   +    t  yr   + +a  +ia l +d+   G s         e + +  q++l+ 
  WP_010892120.1  51 AVTIKCDDHNLIGVLHLPNTPTPeggFPTVVLFHGFRGTKfgglTGAYRKLGRKFAAAGIATLRVDMAGCGDSEGVAEevpIETYLRDAQTILET 145
                     57888999***********86654449******9998765444478888889999*************9999875532111355566679***** PP

         DUF1100 252 ladvpyvdhtrvgliGfrfGanvavrlaflesek 285
                     +++ p ++  r+g+ Gf +G+ +a  la + +++
  WP_010892120.1 146 VQEHPDLNAYRLGISGFSLGCHIAFELAKIYNPR 179
                     ************************9999776655 PP



Or compare WP_010892120.1 to CDD or PaperBLAST