PaperBLAST – Find papers about a protein or its homologs

 

Align WP_011078432.1 to PF06500 (DUF1100)

WP_011078432.1 has 415 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   9.8e-240  781.3   2.4   1.1e-239  781.1   2.4    1.0  1  WP_011078432.1  


Domain annotation for each sequence (and alignments):
>> WP_011078432.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  781.1   2.4  1.1e-239  1.1e-239       2     411 .]       5     414 ..       4     414 .. 1.00

  Alignments for each domain:
  == domain 1  score: 781.1 bits;  conditional E-value: 1.1e-239
         DUF1100   2 vsknlsetlfkkkkkaketsalvrrlptskelldaldektakawyrnlrrlqwiwrGvdpleieevlariasskaertddelldtvvGyrsGnwi 96 
                     vsknlsetlf+k+k+aketsal++++pts++lld+++ek+  +wyrnlrrlqw+w+Gvdp+e+e+vlariassk++rtd+++ldtv+Gy+sGnw+
  WP_011078432.1   5 VSKNLSETLFVKHKQAKETSALTQYMPTSQSLLDEIKEKNGFSWYRNLRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWA 99 
                     79********************************************************************************************* PP

         DUF1100  97 yewaklgmlhqkkaaeekdeeaaeellaaallysiagyphlkgdnlalqaqvlanrayeeaakklkyvlkqlelpvekkkitgflhlpktdkplp 191
                     yew++lgm+hqk+a e+++e+a+e+l++a+l+ysiagyphlk+dnla+qaqvlan+ay eaakk+ky++kqle+p+ek+kit++lhl++tdkp+p
  WP_011078432.1 100 YEWTRLGMEHQKRAGEMTNEAASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAAKKSKYIIKQLEIPFEKGKITAHLHLTNTDKPHP 194
                     *********************************************************************************************** PP

         DUF1100 192 vvlvsaGldslqtdmyrlfrdylakkdiamltidlpsvGasskwkltedssllhqavlkeladvpyvdhtrvgliGfrfGanvavrlaflesekv 286
                     vv+vsaGldslqtdm+rlfrd+lak+diamlt+d+psvG+ssk++lted+s+lhqavl+el+++pyvdh+rvgliGfrfG+n++vrl+fle+ek+
  WP_011078432.1 195 VVIVSAGLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYPLTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKI 289
                     *********************************************************************************************** PP

         DUF1100 287 kavvalGavvhdlltsskklqkvpkmyldvlasrlGksdvdieslsgelnayslkvqGllsgrrtktpilalslegdpvspkednklvalfsadG 381
                     ka+v+lGa++hd+++s++klq++pkmyldvlasrlGks+vdi+slsg+++a+slkvqG+ls+r+tk+pila+slegdpvsp++dn++va+fs++G
  WP_011078432.1 290 KACVILGAPIHDIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMAAWSLKVQGFLSSRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYG 384
                     *********************************************************************************************** PP

         DUF1100 382 klkkissktitkgyeksldlaiewledell 411
                     k+kkissktit+gye+sldlai+wledell
  WP_011078432.1 385 KAKKISSKTITQGYEQSLDLAIKWLEDELL 414
                     ****************************95 PP



Or compare WP_011078432.1 to CDD or PaperBLAST