PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001401158.1 to PF06500 (DUF1100)

XP_001401158.1 has 406 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      7e-16   44.0   0.0    8.7e-16   43.7   0.0    1.1  1  XP_001401158.1  


Domain annotation for each sequence (and alignments):
>> XP_001401158.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   43.7   0.0   8.7e-16   8.7e-16     112     410 ..      88     397 ..      70     398 .. 0.77

  Alignments for each domain:
  == domain 1  score: 43.7 bits;  conditional E-value: 8.7e-16
         DUF1100 112 eekdeeaaeellaaallysiagyphlk..gdnlalqaqvlanrayeeaakklkyvlkqlelpvekkkit..g....flhlpk...tdkplpvvlv 195
                     +++ e a++ l  aa++y i+ +p++    +++ + a     + y +aa   k +++++ +p ++k+ t  +    f+ +p+   +++p+pvv++
  XP_001401158.1  88 NNNVEMASDLLRRAAVVYRISRFPYVDptREDIKKEAFNRQKKVYLKAASFWKPTIQEVIIPHKHKSATdgAyvplFVRVPEhatAENPVPVVVL 182
                     2333478888999***********996225788888888899********************99876652232222555554444789******* PP

         DUF1100 196 saGldslqtdmyrlfrdylakkdiamltidlpsvGasskwklteds.sllhqavlkeladvpyvdhtrvgliGfrfGanvavrlaflesekvkav 289
                      +Gld  + d  +  ++ + +++ a +  ++p    s   +   +s  +   +vl+ +a  p  d  rv++ G+  G+  a+r a+  +++    
  XP_001401158.1 183 MTGLDGYRPDNSQRTHE-IINRGWATVICEIPGTADSPADPSDPESaDRQWTTVLDYMATRPEFDMSRVAAWGLSAGGFYAIRAAHTHRDRFVGT 276
                     **********9876555.6789***********99998887654441566789****************************************** PP

         DUF1100 290 valGavvhdlltsskklqkvpk.....myldvlasrlGksdvdieslsgelnayslkvqGllsgrrtktpilalslegdpvspkednklvalfsa 379
                      a G+  h +  +++ l +v +     +     a + G s+ ++   +g+ +++sl   G+l    ++  +l ++  +d v+p ed  ++    +
  XP_001401158.1 277 LAHGPGCHYF-LDPEWLSRVDDheypfLLTPAWAKKYGYSNPEDFKKHGQ-KKFSLLETGILDQPSCRLLLLNGV--DDGVTPIEDCLMLFNHGS 367
                     *******975.578888777551111144556689999999999888887.78*********8888887777665..899*****9877654332 PP

         DUF1100 380 dGklkkissktitkgyeksldlaiewledel 410
                       k  +        gy +sl    +w+ed l
  XP_001401158.1 368 -PKEGRFFHGLPHMGYPHSLVPSYKWFEDVL 397
                     .222233333346789999999999999876 PP



Or compare XP_001401158.1 to CDD or PaperBLAST