PaperBLAST – Find papers about a protein or its homologs

 

Align XP_009652853.1 to PF06500 (DUF1100)

XP_009652853.1 has 466 amino acids

Query:       DUF1100  [M=411]
Accession:   PF06500.11
Description: Alpha/beta hydrolase of unknown function (DUF1100)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.4e-14   38.5   0.0    4.3e-14   38.1   0.0    1.1  1  XP_009652853.1  


Domain annotation for each sequence (and alignments):
>> XP_009652853.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.1   0.0   4.3e-14   4.3e-14     108     408 ..     144     460 ..     134     463 .. 0.79

  Alignments for each domain:
  == domain 1  score: 38.1 bits;  conditional E-value: 4.3e-14
         DUF1100 108 kkaaeekde.eaaeellaaallysiagyphlkg.dnla....lqaqvlanrayeeaakklkyvlkqlelpvek......kkitgflhlpk....t 186
                      kaa   d+ +a++ +l a+ ly ia +p++ +  +++     +a     ++y +aa   +  + ++e+p  +      ++i  ++ lp+     
  XP_009652853.1 144 DKAASAGDPkQASQLYLRACALYRIARFPYITAfPDIScpikWKAWQWQKETYLKAASAWECPVEEVEIPHMHkqgrdrANIPVYVRLPRslssR 238
                     467777777699999***************986334441111577788899******************975311122357999**999854223 PP

         DUF1100 187 dkplpvvlvsaGldslqtdmyrlfrdylakkdiamltidlpsvGasskwklteds.sllhqavlkeladvpyvdhtrvgliGfrfGanvavrlaf 280
                      +p pvvl+ +Gld  + d   l  d +  ++   + +++p            ds  +l   vl+ +a     d  +v + G+  G+  avr+a+
  XP_009652853.1 239 RQPCPVVLLMTGLDGYRPDN-TLRCDEFLSRGWGSVVVEIPGTADCPADSADPDSpDRLWSSVLDWMAADGRFDMGKVMVWGLSSGGYYAVRIAH 332
                     5799***************7.5667777889**********99988777777776369************************************* PP

         DUF1100 281 lesekvkavvalGavvhdlltss....kklqkvpkmyldvlasrlGksdvdieslsgelnayslkvqGllsgrrtktpilalslegdpvspkedn 371
                       +e++   +a Ga  h  + +        ++ p      +a + G ++v  +   ++ +++sl   G++  ++  t +l +   +d + p ed+
  XP_009652853.1 333 THKERLIGSIAQGAGCHYSFDEEwldkADGHEYPFRLTPAMAMKHGYETVAEYKTGVQ-KKFSLLDTGII--QQPSTRLLLINGTQDGLMPIEDS 424
                     *****************99876411103445677777889999999999988876666.789*******9..7778888888889999*****99 PP

         DUF1100 372 klvalfsadGklkkissktitkgyeksldlaiewled 408
                      ++  + +  +++  +  ++  gy  +   +  w+e+
  XP_009652853.1 425 IMLFEYGTPKEARFFP-GALHMGYPMANGSVYPWMEK 460
                     8877665544444333.45777777777777777776 PP



Or compare XP_009652853.1 to CDD or PaperBLAST