PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS619083 to PF06526 (DUF1107)

VIMSS619083 has 70 amino acids

Query:       DUF1107  [M=63]
Accession:   PF06526.16
Description: Protein of unknown function (DUF1107)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-32   98.1   0.7    1.2e-32   98.0   0.7    1.0  1  VIMSS619083  


Domain annotation for each sequence (and alignments):
>> VIMSS619083  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.0   0.7   1.2e-32   1.2e-32       1      63 []       1      63 [.       1      63 [. 0.98

  Alignments for each domain:
  == domain 1  score: 98.0 bits;  conditional E-value: 1.2e-32
      DUF1107  1 mriFkkYaPlqIAkyvktffkGrlyikglGrfeFdkGrlllpkkadkkvlkvvseiNeeikel 63
                 mriF++Y+P+++A yvkt+f+Grlyik++G+feFd+G++l+pk++dk++ +v+ e+N+++ +l
  VIMSS619083  1 MRIFQRYNPAKVAMYVKTLFRGRLYIKDMGAFEFDNGKILVPKVKDKRHFEVMAEVNRQVLRL 63
                 9**********************************************************9886 PP



Or compare VIMSS619083 to CDD or PaperBLAST