VIMSS619083 has 70 amino acids
Query: DUF1107 [M=63] Accession: PF06526.16 Description: Protein of unknown function (DUF1107) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-32 98.1 0.7 1.2e-32 98.0 0.7 1.0 1 VIMSS619083 Domain annotation for each sequence (and alignments): >> VIMSS619083 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.0 0.7 1.2e-32 1.2e-32 1 63 [] 1 63 [. 1 63 [. 0.98 Alignments for each domain: == domain 1 score: 98.0 bits; conditional E-value: 1.2e-32 DUF1107 1 mriFkkYaPlqIAkyvktffkGrlyikglGrfeFdkGrlllpkkadkkvlkvvseiNeeikel 63 mriF++Y+P+++A yvkt+f+Grlyik++G+feFd+G++l+pk++dk++ +v+ e+N+++ +l VIMSS619083 1 MRIFQRYNPAKVAMYVKTLFRGRLYIKDMGAFEFDNGKILVPKVKDKRHFEVMAEVNRQVLRL 63 9**********************************************************9886 PP
Or compare VIMSS619083 to CDD or PaperBLAST