PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9D9T8 to PF06565 (DUF1126)

SwissProt::Q9D9T8 has 648 amino acids

Query:       DUF1126  [M=105]
Accession:   PF06565.12
Description: DUF1126 PH-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   3.7e-106  334.4   4.4    1.3e-39  120.6   0.1    3.4  3  SwissProt::Q9D9T8  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9D9T8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  108.6   0.3   7.1e-36   7.1e-36       2     105 .]      87     190 ..      86     190 .. 0.96
   2 !  120.6   0.1   1.3e-39   1.3e-39       1     105 []     232     351 ..     232     351 .. 0.91
   3 !  105.5   0.0   6.4e-35   6.4e-35       3     104 ..     411     511 ..     409     512 .. 0.93

  Alignments for each domain:
  == domain 1  score: 108.6 bits;  conditional E-value: 7.1e-36
            DUF1126   2 kkflendrkvLrFyalwddk.resleeeer..kfvisyyleDdtieikEprqrNsGikggkflkRqklpkpeeeakgeyytpkdlnvgatvn 90 
                        ++++++d+kvL+F+a+++++ + s+ee++r  ++ i+yyleDd++++ Ep ++NsGi++gk++kRq+  k  ++  g++y++kdln g +++
  SwissProt::Q9D9T8  87 PAHVAFDKKVLKFSAYFQEDvPISMEEHYRirHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTK--ND-MGDHYHWKDLNRGINLT 175
                        67899****************99999999999**************************************..44.69*************** PP

            DUF1126  91 vfgrkfllldcdeft 105
                        v+g++f+++dcd ft
  SwissProt::Q9D9T8 176 VYGKTFRIVDCDRFT 190
                        *************98 PP

  == domain 2  score: 120.6 bits;  conditional E-value: 1.3e-39
            DUF1126   1 lkkflendrkvLrFyalwddkresleeeerkfvisyyleDdtieikEprqrNsG..ikggkflkRqklpk...peeea.............k 74 
                        lk+fl++d++vLrFya+wdd ++sl++e r+++i+yyl Ddt+ei+E+++rN+G  + ++ +++Rq++pk   ++  +              
  SwissProt::Q9D9T8 232 LKQFLTFDKQVLRFYAIWDD-TDSLFGECRHYIIHYYLMDDTVEIREVHERNNGrdP-FPLLMNRQRMPKvlvENA-KnfpkcvleisdqeV 320
                        589*****************.7*********************************55.9***********874332.268999999886555 PP

            DUF1126  75 geyytpkdlnvgatvnvfgrkfllldcdeft 105
                         e+yt+kd+ vg+ ++++gr+f+++dcd ft
  SwissProt::Q9D9T8 321 LEWYTAKDFIVGKPLTILGRTFFIYDCDPFT 351
                        55***************************98 PP

  == domain 3  score: 105.5 bits;  conditional E-value: 6.4e-35
            DUF1126   3 kflendrkvLrFyalwddkresleeeerkfvisyyleDdtieikEprqrNsGikggkflkRqklpkpeeea.kgeyytpkdlnvgatvnvfg 93 
                        k+l nd+kvLr+ a ++++   +e+++r+fv+sy+l+ d i+i+Ep++rNsGi ggkfl R+k+ k+ ++  ++ yy+p+d+ +ga+++vfg
  SwissProt::Q9D9T8 411 KMLMNDNKVLRYLAALESP--IPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVdNPIYYSPSDFFIGAVIEVFG 500
                        7899**************8..9******************************99************444434677***************** PP

            DUF1126  94 rkfllldcdef 104
                        ++f++ld de+
  SwissProt::Q9D9T8 501 HRFVILDTDEY 511
                        **********8 PP



Or compare SwissProt::Q9D9T8 to CDD or PaperBLAST