VIMSS1053680 has 48 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.8e-22 63.4 0.1 8.4e-22 63.1 0.1 1.1 1 VIMSS1053680
Domain annotation for each sequence (and alignments):
>> VIMSS1053680
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.1 0.1 8.4e-22 8.4e-22 1 37 [] 3 39 .. 3 39 .. 0.96
Alignments for each domain:
== domain 1 score: 63.1 bits; conditional E-value: 8.4e-22
DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
l++ +++Wrr+R+t++eL++Ls reL+D+G+sR+di+
VIMSS1053680 3 LFRSYNNWRRYRETVNELNQLSTRELNDLGISRADIP 39
6899*******************************95 PP
Or compare VIMSS1053680 to CDD or PaperBLAST