PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1055629 to PF06568 (DUF1127)

VIMSS1055629 has 45 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.11
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.1e-19   53.3   1.0    9.9e-19   53.2   1.0    1.0  1  VIMSS1055629  


Domain annotation for each sequence (and alignments):
>> VIMSS1055629  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   53.2   1.0   9.9e-19   9.9e-19       1      37 []       3      39 ..       3      39 .. 0.95

  Alignments for each domain:
  == domain 1  score: 53.2 bits;  conditional E-value: 9.9e-19
       DUF1127  1 llaalrrWrrrRrtrreLarLsDreLaDIGlsRsdir 37
                  +++++ ++ +rRr+ reL++++D++LaDIG+sRs+i+
  VIMSS1055629  3 IRQKVMQYVSRRRALRELGAMDDHLLADIGVSRSQIQ 39
                  5789999****************************95 PP



Or compare VIMSS1055629 to CDD or PaperBLAST