PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS122900 to PF06568 (DUF1127)

VIMSS122900 has 45 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.11
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.6e-18   51.4   0.2      4e-18   51.2   0.2    1.0  1  VIMSS122900  


Domain annotation for each sequence (and alignments):
>> VIMSS122900  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.2   0.2     4e-18     4e-18       1      37 []       3      39 ..       3      39 .. 0.94

  Alignments for each domain:
  == domain 1  score: 51.2 bits;  conditional E-value: 4e-18
      DUF1127  1 llaalrrWrrrRrtrreLarLsDreLaDIGlsRsdir 37
                 ++++++ +   Rr++reL++L+D+ L DIG+sRs+i+
  VIMSS122900  3 IRQKITEYVKMRRAVRELNALDDHALSDIGISRSQIQ 39
                 5789999999*************************95 PP



Or compare VIMSS122900 to CDD or PaperBLAST