VIMSS122900 has 45 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-17 47.5 0.2 6.5e-17 47.4 0.2 1.1 1 VIMSS122900
Domain annotation for each sequence (and alignments):
>> VIMSS122900
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 47.4 0.2 6.5e-17 6.5e-17 2 37 .] 4 39 .. 3 39 .. 0.91
Alignments for each domain:
== domain 1 score: 47.4 bits; conditional E-value: 6.5e-17
DUF1127 2 raalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
r++++ + Rr +reL++L+D++L DIG+sRs+i+
VIMSS122900 4 RQKITEYVKMRRAVRELNALDDHALSDIGISRSQIQ 39
7788888888************************95 PP
Or compare VIMSS122900 to CDD or PaperBLAST