PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS123441 to PF06568 (DUF1127)

VIMSS123441 has 98 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.11
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-13   36.0   4.5    2.3e-13   36.0   4.5    1.6  2  VIMSS123441  


Domain annotation for each sequence (and alignments):
>> VIMSS123441  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   36.0   4.5   2.3e-13   2.3e-13       2      36 ..      30      64 ..      29      65 .. 0.93
   2 ?   -2.2   0.3       0.2       0.2       4      10 ..      84      90 ..      80      97 .. 0.48

  Alignments for each domain:
  == domain 1  score: 36.0 bits;  conditional E-value: 2.3e-13
      DUF1127  2 laalrrWrrrRrtrreLarLsDreLaDIGlsRsdi 36
                 l a++r  r+R++++ L++L+Dr+L D Gl R+d+
  VIMSS123441 30 LTAVWRLYRNRCQIARLQDLDDRQLLDMGLKREDL 64
                 67899999**************************8 PP

  == domain 2  score: -2.2 bits;  conditional E-value: 0.2
      DUF1127  4 alrrWrr 10
                   +r + 
  VIMSS123441 84 SRNRANL 90
                 3334444 PP



Or compare VIMSS123441 to CDD or PaperBLAST