VIMSS124220 has 47 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.4e-21 59.7 0.1 1.1e-20 59.4 0.1 1.1 1 VIMSS124220
Domain annotation for each sequence (and alignments):
>> VIMSS124220
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.4 0.1 1.1e-20 1.1e-20 1 37 [] 3 39 .. 3 39 .. 0.96
Alignments for each domain:
== domain 1 score: 59.4 bits; conditional E-value: 1.1e-20
DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
l++ +++Wr +R+t +eL+r+sDreL D+G+ R+di+
VIMSS124220 3 LARSFNNWRKYRQTCNELGRMSDRELTDLGIGRADIP 39
7899*******************************95 PP
Or compare VIMSS124220 to CDD or PaperBLAST