PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS61907 to PF06568 (DUF1127)

VIMSS61907 has 70 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.11
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.8e-16   44.6   0.2      6e-16   44.3   0.2    1.1  1  VIMSS61907  


Domain annotation for each sequence (and alignments):
>> VIMSS61907  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.3   0.2     6e-16     6e-16       1      36 [.      25      60 ..      25      61 .. 0.95

  Alignments for each domain:
  == domain 1  score: 44.3 bits;  conditional E-value: 6e-16
     DUF1127  1 llaalrrWrrrRrtrreLarLsDreLaDIGlsRsdi 36
                ll++l++Wr++ r+r++La++s+++LaD+ +s+s++
  VIMSS61907 25 LLEKLNSWRQNARSRKHLAQMSEHDLADLAISPSER 60
                67899*****************************97 PP



Or compare VIMSS61907 to CDD or PaperBLAST