VIMSS61907 has 70 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-16 46.4 0.2 1.6e-16 46.1 0.2 1.1 1 VIMSS61907
Domain annotation for each sequence (and alignments):
>> VIMSS61907
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 46.1 0.2 1.6e-16 1.6e-16 1 37 [] 25 61 .. 25 61 .. 0.95
Alignments for each domain:
== domain 1 score: 46.1 bits; conditional E-value: 1.6e-16
DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
l+++l++Wr+++r+r++La++s+++LaD+ +s+s+++
VIMSS61907 25 LLEKLNSWRQNARSRKHLAQMSEHDLADLAISPSERY 61
6789******************************985 PP
Or compare VIMSS61907 to CDD or PaperBLAST