WP_000397917.1 has 54 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-16 46.1 7.6 2e-16 45.8 7.6 1.1 1 WP_000397917.1
Domain annotation for each sequence (and alignments):
>> WP_000397917.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 45.8 7.6 2e-16 2e-16 1 37 [] 18 54 .] 18 54 .] 0.97
Alignments for each domain:
== domain 1 score: 45.8 bits; conditional E-value: 2e-16
DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
lr+al+rW+ r+r ++L+r+sD++L+DIGL+R d++
WP_000397917.1 18 LRRALKRWWLRKRACQALRRMSDEQLRDIGLERKDVE 54
79*********************************86 PP
Or compare WP_000397917.1 to CDD or PaperBLAST