PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000397917.1 to PF06568 (DUF1127)

WP_000397917.1 has 54 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.11
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-16   46.0   8.0      2e-16   45.8   8.0    1.1  1  WP_000397917.1  


Domain annotation for each sequence (and alignments):
>> WP_000397917.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.8   8.0     2e-16     2e-16       1      37 []      18      54 .]      18      54 .] 0.97

  Alignments for each domain:
  == domain 1  score: 45.8 bits;  conditional E-value: 2e-16
         DUF1127  1 llaalrrWrrrRrtrreLarLsDreLaDIGlsRsdir 37
                    l++al+rW+ r+r+  +L r+sD++L+DIGl R d++
  WP_000397917.1 18 LRRALKRWWLRKRACQALRRMSDEQLRDIGLERKDVE 54
                    79********************************985 PP



Or compare WP_000397917.1 to CDD or PaperBLAST