PaperBLAST – Find papers about a protein or its homologs

 

Align ecocyc::G7937-MONOMER to PF06568 (DUF1127)

ecocyc::G7937-MONOMER has 54 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.11
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    1.3e-18   52.8   8.1    1.6e-18   52.5   8.1    1.2  1  ecocyc::G7937-MONOMER  


Domain annotation for each sequence (and alignments):
>> ecocyc::G7937-MONOMER  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   52.5   8.1   1.6e-18   1.6e-18       1      37 []      18      54 .]      18      54 .] 0.97

  Alignments for each domain:
  == domain 1  score: 52.5 bits;  conditional E-value: 1.6e-18
                DUF1127  1 llaalrrWrrrRrtrreLarLsDreLaDIGlsRsdir 37
                           l++a+rrWrr ++trr L+++sD+ L+DIGl+R+d++
  ecocyc::G7937-MONOMER 18 LWQAVRRWRRQMQTRRVLQQMSDERLKDIGLRREDVE 54
                           89*********************************86 PP



Or compare ecocyc::G7937-MONOMER to CDD or PaperBLAST