VIMSS2194611 has 75 amino acids
Query: DUF1161 [M=52] Accession: PF06649.16 Description: Protein of unknown function (DUF1161) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.2 2.3 1.3e-30 91.9 2.3 1.1 1 VIMSS2194611 Domain annotation for each sequence (and alignments): >> VIMSS2194611 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.9 2.3 1.3e-30 1.3e-30 1 52 [] 25 74 .. 25 74 .. 1.00 Alignments for each domain: == domain 1 score: 91.9 bits; conditional E-value: 1.3e-30 DUF1161 1 CeelkaeIdaKiqanGVtsytLeiVdkdeaakasgkVVGsCengtkkIvYqR 52 CeelkaeIdaKi+anGV ytLeiVdk+++ +++kVVG+C++gtk+IvYqR VIMSS2194611 25 CEELKAEIDAKIKANGVPAYTLEIVDKGSV--TDKKVVGTCDGGTKEIVYQR 74 ******************************..9******************9 PP
Or compare VIMSS2194611 to CDD or PaperBLAST