VIMSS2194611 has 75 amino acids
Query: DUF1161 [M=52]
Accession: PF06649.16
Description: Protein of unknown function (DUF1161)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-30 92.2 2.3 1.3e-30 91.9 2.3 1.1 1 VIMSS2194611
Domain annotation for each sequence (and alignments):
>> VIMSS2194611
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.9 2.3 1.3e-30 1.3e-30 1 52 [] 25 74 .. 25 74 .. 1.00
Alignments for each domain:
== domain 1 score: 91.9 bits; conditional E-value: 1.3e-30
DUF1161 1 CeelkaeIdaKiqanGVtsytLeiVdkdeaakasgkVVGsCengtkkIvYqR 52
CeelkaeIdaKi+anGV ytLeiVdk+++ +++kVVG+C++gtk+IvYqR
VIMSS2194611 25 CEELKAEIDAKIKANGVPAYTLEIVDKGSV--TDKKVVGTCDGGTKEIVYQR 74
******************************..9******************9 PP
Or compare VIMSS2194611 to CDD or PaperBLAST