PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::AAC64928.1 to PF06722 (DUF1205)

CAZy::AAC64928.1 has 393 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    4.4e-16   45.1   0.0    1.1e-15   43.8   0.0    1.7  1  CAZy::AAC64928.1  


Domain annotation for each sequence (and alignments):
>> CAZy::AAC64928.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   43.8   0.0   1.1e-15   1.1e-15       1      95 []     172     265 ..     172     265 .. 0.94

  Alignments for each domain:
  == domain 1  score: 43.8 bits;  conditional E-value: 1.1e-15
                       EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SS CS
           DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdn 93 
                       id++P+ l+   + ++v++ryvp   +  v+ Wl + + ++Rvcvt Gt     + +++l  + + ++ +l  E+v+   +e+    + lp +
  CAZy::AAC64928.1 172 IDPCPAPLQRPGADAVVPVRYVPVDRPGTVPAWLLEPPRGPRVCVTWGTFADGMPGGHPL-MRAMRALPRLGVEVVLVARAEDLARQGGLPAG 263
                       8************************************************99996666655.5679*******************999999999 PP

                       EE CS
           DUF1205  94 vR 95 
                       vR
  CAZy::AAC64928.1 264 VR 265
                       98 PP



Or compare CAZy::AAC64928.1 to CDD or PaperBLAST