PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::AAD13553.1 to PF06722 (DUF1205)

CAZy::AAD13553.1 has 373 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    2.3e-25   74.9   0.0    4.1e-25   74.1   0.0    1.4  1  CAZy::AAD13553.1  


Domain annotation for each sequence (and alignments):
>> CAZy::AAD13553.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.1   0.0   4.1e-25   4.1e-25       1      95 []     171     264 ..     171     264 .. 0.96

  Alignments for each domain:
  == domain 1  score: 74.1 bits;  conditional E-value: 4.1e-25
                       EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SS CS
           DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdn 93 
                       +d++Ppslr+ ++ +++ mr+vp Ng+  +e+W+++k +r+R++vt G      ++++ +l+ +++++a+lDaE+v+a  +e ++elr  +++
  CAZy::AAD13553.1 171 VDICPPSLRPATAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVF-AKKTGFLRGLVADMAALDAEVVIATLDEVAEELRTELPG 262
                       79**********************************************88887.7789*********************9999******9999 PP

                       EE CS
           DUF1205  94 vR 95 
                       vR
  CAZy::AAD13553.1 263 VR 264
                       98 PP



Or compare CAZy::AAD13553.1 to CDD or PaperBLAST