PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::AAF01811.1 to PF06722 (DUF1205)

CAZy::AAF01811.1 has 390 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    4.8e-23   67.5   0.0    1.5e-22   65.9   0.0    1.8  2  CAZy::AAF01811.1  


Domain annotation for each sequence (and alignments):
>> CAZy::AAF01811.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   65.9   0.0   1.5e-22   1.5e-22      13      95 .]     200     281 ..     183     281 .. 0.85
   2 ?   -1.9   0.0      0.21      0.21      44      69 ..     335     360 ..     316     368 .. 0.68

  Alignments for each domain:
  == domain 1  score: 65.9 bits;  conditional E-value: 1.5e-22
                       ---EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SSEE CS
           DUF1205  13 gketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdnvR 95 
                          + +mryvpyNg++v+++Wl   + r+R++vtlG   a  + +   l+ ++ +va++DaE v++l + +   l+elp nvR
  CAZy::AAF01811.1 200 SPGAWPMRYVPYNGGAVLPDWLPPAAGRRRIAVTLGSIDAL-SGGIAKLAPLFSEVADVDAEFVLTLGGGDLALLGELPANVR 281
                       335789******************************87776.777899**********************************9 PP

  == domain 2  score: -1.9 bits;  conditional E-value: 0.21
                       EEE-------------STTTTHHHHH CS
           DUF1205  44 cvtlGtskaedladadlleavldqva 69 
                       ++ +G+  + ++ +a++ +++ld+++
  CAZy::AAF01811.1 335 GLGIGFDAEAGSLGAEQCRRLLDDAG 360
                       34556666668888999999999876 PP



Or compare CAZy::AAF01811.1 to CDD or PaperBLAST