PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::BAD08357.1 to PF06722 (DUF1205)

CAZy::BAD08357.1 has 419 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    3.5e-29   87.1   0.1      1e-28   85.6   0.0    1.9  2  CAZy::BAD08357.1  


Domain annotation for each sequence (and alignments):
>> CAZy::BAD08357.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   85.6   0.0     1e-28     1e-28       3      95 .]     208     300 ..     206     300 .. 0.98
   2 ?   -4.1   0.0      0.97      0.97      28      36 ..     337     345 ..     325     348 .. 0.75

  Alignments for each domain:
  == domain 1  score: 85.6 bits;  conditional E-value: 1e-28
                       -S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SSEE CS
           DUF1205   3 vaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdnvR 95 
                       vaPp ++    +++ smr++p+Ng++v+++Wl++ + r+Rvc+tlG++ +e ++d+++l+  +++va++Da++v+++++e+  e+++lpdnvR
  CAZy::BAD08357.1 208 VAPPWMSFPSEQPALSMRHLPFNGPAVLPDWLREAPSRPRVCLTLGLTLRELADDNVTLADFVNAVADIDADVVATFSAEQVAEIGDLPDNVR 300
                       79******************************************************************************************9 PP

  == domain 2  score: -4.1 bits;  conditional E-value: 0.97
                       ----GGGSS CS
           DUF1205  28 svveeWlkk 36 
                        +v++Wl +
  CAZy::BAD08357.1 337 LIVPNWLWD 345
                       589999966 PP



Or compare CAZy::BAD08357.1 to CDD or PaperBLAST