PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::CAC37807.1 to PF06722 (DUF1205)

CAZy::CAC37807.1 has 436 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    1.1e-35  108.0   0.0      2e-35  107.2   0.0    1.5  1  CAZy::CAC37807.1  


Domain annotation for each sequence (and alignments):
>> CAZy::CAC37807.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  107.2   0.0     2e-35     2e-35       1      95 []     211     305 ..     211     305 .. 0.99

  Alignments for each domain:
  == domain 1  score: 107.2 bits;  conditional E-value: 2e-35
                       EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SS CS
           DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdn 93 
                       +d++P+ lr+d+g++tv+mryvpyNg+svv+ Wl ++++r+Rvc+tlG s++e+  +++++ ++ld++a++DaE v+++d+++  +++++p n
  CAZy::CAC37807.1 211 VDPIPEPLRIDTGVRTVGMRYVPYNGPSVVPAWLLREPERRRVCLTLGGSSREHGIGQVSIGEMLDAIADIDAEFVATFDDQQLVGVGSVPAN 303
                       799****************************************************************************************** PP

                       EE CS
           DUF1205  94 vR 95 
                       vR
  CAZy::CAC37807.1 304 VR 305
                       *9 PP



Or compare CAZy::CAC37807.1 to CDD or PaperBLAST