PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::CAC37814.1 to PF06722 (DUF1205)

CAZy::CAC37814.1 has 417 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    5.9e-26   76.8   0.0    1.1e-25   75.9   0.0    1.4  1  CAZy::CAC37814.1  


Domain annotation for each sequence (and alignments):
>> CAZy::CAC37814.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   75.9   0.0   1.1e-25   1.1e-25       1      95 []     207     298 ..     207     298 .. 0.94

  Alignments for each domain:
  == domain 1  score: 75.9 bits;  conditional E-value: 1.1e-25
                       EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SS CS
           DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdn 93 
                       +d++P+s+rl++g e+v  r++pyNg+svv++Wl++    +Rvc t G s    +++ + + ++l+ +a++D+Eivv+ ++ +     ++pdn
  CAZy::CAC37814.1 207 VDQLPESFRLETGLESVHTRTLPYNGSSVVPQWLRTSDGVRRVCFTGGYSALGITSNPQEFLRTLATLARFDGEIVVTRSGLDPA---SVPDN 296
                       79***************************************************77777788899**************9998876...99*** PP

                       EE CS
           DUF1205  94 vR 95 
                       vR
  CAZy::CAC37814.1 297 VR 298
                       99 PP



Or compare CAZy::CAC37814.1 to CDD or PaperBLAST