PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::CAC37820.1 to PF06722 (DUF1205)

CAZy::CAC37820.1 has 422 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    9.4e-40  121.0   0.1    1.7e-39  120.2   0.1    1.4  1  CAZy::CAC37820.1  


Domain annotation for each sequence (and alignments):
>> CAZy::CAC37820.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  120.2   0.1   1.7e-39   1.7e-39       1      95 []     209     303 ..     209     303 .. 0.99

  Alignments for each domain:
  == domain 1  score: 120.2 bits;  conditional E-value: 1.7e-39
                       EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SS CS
           DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdn 93 
                       id+aP  +rld+g +tv+mryv+yNg+svv++Wl++++ r+Rvc+tlG+s++e++ ++++++ +l++++++DaEi++++de++ ++++++p n
  CAZy::CAC37820.1 209 IDPAPVGMRLDTGLRTVGMRYVDYNGPSVVPDWLHDEPTRRRVCLTLGISSRENSIGQVSVDDLLGALGDVDAEIIATVDEQQLEGVAHVPAN 301
                       8******************************************************************************************** PP

                       EE CS
           DUF1205  94 vR 95 
                       +R
  CAZy::CAC37820.1 302 IR 303
                       *9 PP



Or compare CAZy::CAC37820.1 to CDD or PaperBLAST