PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O33939 to PF06722 (DUF1205)

SwissProt::O33939 has 415 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.5e-38  114.6   0.0    2.3e-37  113.4   0.0    1.7  2  SwissProt::O33939  


Domain annotation for each sequence (and alignments):
>> SwissProt::O33939  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.4   0.0   2.3e-37   2.3e-37       1      95 []     207     298 ..     207     298 .. 0.99
   2 ?   -3.0   0.0      0.46      0.46      45      68 ..     353     376 ..     336     379 .. 0.57

  Alignments for each domain:
  == domain 1  score: 113.4 bits;  conditional E-value: 2.3e-37
                        EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--S CS
            DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpd 92 
                        +d++Pps+rld+g+etv++r++pyNgasvv++Wlkk+sa++R+c+t G+s    +adad+++++l+q+a++D+Eivv+ +++++s   ++pd
  SwissProt::O33939 207 VDQLPPSFRLDTGMETVVARTLPYNGASVVPDWLKKGSATRRICITGGFSGLGLAADADQFARTLAQLARFDGEIVVTGSGPDTS---AVPD 295
                        79**********************************************************************************9...99** PP

                        SEE CS
            DUF1205  93 nvR 95 
                        n+R
  SwissProt::O33939 296 NIR 298
                        *99 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.46
                        EE-------------STTTTHHHH CS
            DUF1205  45 vtlGtskaedladadlleavldqv 68 
                        +  G+  + d  dad+l+  l qv
  SwissProt::O33939 353 LGAGIYLRPDEVDADSLASALTQV 376
                        444555555555666666666666 PP



Or compare SwissProt::O33939 to CDD or PaperBLAST