SwissProt::Q54824 has 431 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-48 148.1 0.3 1.4e-47 147.4 0.3 1.4 1 SwissProt::Q54824 Domain annotation for each sequence (and alignments): >> SwissProt::Q54824 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 147.4 0.3 1.4e-47 1.4e-47 2 145 .] 272 417 .. 271 417 .. 0.96 Alignments for each domain: == domain 1 score: 147.4 bits; conditional E-value: 1.4e-47 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagi 93 ++l+++aelDaE+v+++++++r++l lp+nvR+vd + l+v+lp+caa+vHhgGag+++ta+ +GvPq+ l+ ++d ra ++ +lGagi SwissProt::Q54824 272 ELLASIAELDAEVVATVKAEEREGLPPLPGNVRVVDSLSLHVVLPSCAAVVHHGGAGTWATAALHGVPQLALAWQWDDVFRAGQLEKLGAGI 363 5899**************************************************************************************** PP EryCIII-like_C 94 vlskde..ltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 l++++ + + ++++ +a+v+++p++r++aa++++e++ +P+P v+++le+l SwissProt::Q54824 364 FLPPHGegASAGRVRDRLAQVLAEPSFRQGAARIRAEMLRTPAPGAVVPTLEQL 417 **98651167779**************************************997 PP
Or compare SwissProt::Q54824 to CDD or PaperBLAST