PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3587079 to PF06722 (DUF1205)

VIMSS3587079 has 387 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.8e-30   91.2   0.3    4.2e-30   90.1   0.0    1.8  2  VIMSS3587079  


Domain annotation for each sequence (and alignments):
>> VIMSS3587079  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.1   0.0   4.2e-30   4.2e-30       1      94 [.     172     264 ..     172     265 .. 0.99
   2 ?   -3.5   0.1      0.64      0.64      32      42 ..     375     386 ..     374     386 .. 0.74

  Alignments for each domain:
  == domain 1  score: 90.1 bits;  conditional E-value: 4.2e-30
                   EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SSE CS
       DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdnv 94 
                   id++Ppslrl d+ ++++mr++p+N +  +e+W++k+ a +R++vt+Gt++a+ ++++d+l+a++++++  DaE+vv ++e+  ++lr++++nv
  VIMSS3587079 172 IDITPPSLRLPDAAPAQTMRWIPGNTQCLLEPWMYKRGADTRIGVTIGTGVAR-YNQYDFLQAIVENISIPDAEVVVPITEDSLPGLRDRLKNV 264
                   8****************************************************.999************************************9 PP

  == domain 2  score: -3.5 bits;  conditional E-value: 0.64
                   GGGSS-.-SS-E CS
       DUF1205  32 eWlkkk.sarkR 42 
                   eWl ++ +ar+R
  VIMSS3587079 375 EWLVHTePARRR 386
                   798655499998 PP



Or compare VIMSS3587079 to CDD or PaperBLAST