PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3651482 to PF06722 (DUF1205)

VIMSS3651482 has 421 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.3e-43  132.1   0.0    1.1e-42  130.5   0.0    1.8  2  VIMSS3651482  


Domain annotation for each sequence (and alignments):
>> VIMSS3651482  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.0   0.0      0.23      0.23      60      77 ..     184     203 ..     176     205 .. 0.75
   2 !  130.5   0.0   1.1e-42   1.1e-42       1      95 []     208     302 ..     208     302 .. 1.00

  Alignments for each domain:
  == domain 1  score: -2.0 bits;  conditional E-value: 0.23
                   STTTTHHHHH..TSSSEEEE CS
       DUF1205  60 lleavldqva..elDaEivv 77 
                    l+++l++ +  ++D E+vv
  VIMSS3651482 184 WLTWTLEKYGgpAFDEEVVV 203
                   56777887764479999998 PP

  == domain 2  score: 130.5 bits;  conditional E-value: 1.1e-42
                   EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SSEE CS
       DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdnvR 95 
                   id+aP+++rld+g +tv+mryv+yNg+svv+eWl+++++r+Rvc+tlG+s++e++ +++++e++l++v+++DaEi++++d+++ ++++++pdnvR
  VIMSS3651482 208 IDPAPAAIRLDTGLKTVGMRYVDYNGPSVVPEWLHDEPERRRVCLTLGISSRENSIGQVSIEELLGAVGDVDAEIIATFDAQQLEGVANIPDNVR 302
                   8*********************************************************************************************9 PP



Or compare VIMSS3651482 to CDD or PaperBLAST