PaperBLAST – Find papers about a protein or its homologs

 

Align WP_003951747.1 to PF06722 (DUF1205)

WP_003951747.1 has 426 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.3e-29   87.2   0.0    5.6e-29   86.5   0.0    1.4  1  WP_003951747.1  


Domain annotation for each sequence (and alignments):
>> WP_003951747.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   86.5   0.0   5.6e-29   5.6e-29       6      95 .]     219     307 ..     214     307 .. 0.93

  Alignments for each domain:
  == domain 1  score: 86.5 bits;  conditional E-value: 5.6e-29
                     GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS-SS--SSEE CS
         DUF1205   6 pslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearselrelpdnvR 95 
                     p  +ld + et +mryvpyNg+svv+eWl++ ++r+Rvc+tlG+s +   ++  ++ ++l+  a+lDaE+vv+l  +a+  l+ lp nvR
  WP_003951747.1 219 PGTELDVAGETLGMRYVPYNGPSVVPEWLRRPAERRRVCLTLGLSDEI-ENTGTTIGEILAGCADLDAEVVVTLAPDAAAALGTLPSNVR 307
                     556789999************************************999.566899**********************************9 PP



Or compare WP_003951747.1 to CDD or PaperBLAST