PaperBLAST – Find papers about a protein or its homologs

 

Align metacyc::MONOMER-17055 to PF06722 (DUF1205)

metacyc::MONOMER-17055 has 426 amino acids

Query:       DUF1205  [M=95]
Accession:   PF06722.12
Description: Protein of unknown function (DUF1205)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    9.2e-36  108.2   0.1    1.5e-35  107.5   0.1    1.3  1  metacyc::MONOMER-17055  


Domain annotation for each sequence (and alignments):
>> metacyc::MONOMER-17055  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  107.5   0.1   1.5e-35   1.5e-35       1      95 []     206     300 ..     206     300 .. 0.99

  Alignments for each domain:
  == domain 1  score: 107.5 bits;  conditional E-value: 1.5e-35
                             EE-S-GGGS------EEE-------SS----GGGSS--SS-EEEEE-------------STTTTHHHHHTSSSEEEE---TTTTSS- CS
                 DUF1205   1 idvaPpslrlddgketvsmryvpyNgasvveeWlkkksarkRvcvtlGtskaedladadlleavldqvaelDaEivvaldeearsel 87 
                             id++P s+rl +g+ tv+mryvpyNg +vv+ W+++++ r+R+c+tlG+s ++ l d ++l++vl++++++DaEiv++ld+++r+ l
  metacyc::MONOMER-17055 206 IDPLPRSMRLPTGTTTVPMRYVPYNGRAVVPAWVRQRARRPRICLTLGVSARQTLGDGVSLAEVLAALGDVDAEIVATLDASQRKLL 292
                             89************************************************************************************* PP

                             SS--SSEE CS
                 DUF1205  88 relpdnvR 95 
                             + +pdnvR
  metacyc::MONOMER-17055 293 GPVPDNVR 300
                             *******9 PP



Or compare metacyc::MONOMER-17055 to CDD or PaperBLAST