SwissProt::A0A086F3E3 has 192 amino acids
Query: TMEM175 [M=88] Accession: PF06736.15 Description: Endosomal/lysosomal potassium channel TMEM175 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-39 119.8 2.1 2.9e-39 119.8 2.1 2.3 2 SwissProt::A0A086F3E3 Domain annotation for each sequence (and alignments): >> SwissProt::A0A086F3E3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 119.8 2.1 2.9e-39 2.9e-39 1 88 [] 5 89 .. 5 89 .. 0.99 2 ! 2.9 0.5 0.0085 0.0085 11 49 .. 116 165 .. 113 182 .. 0.55 Alignments for each domain: == domain 1 score: 119.8 bits; conditional E-value: 2.9e-39 TMEM175 1 RleafsDgvfAiaiTllvlelkvpekeeeellaallellpellayllsFlvvaifWinhhrlfrlikkvdkrllwlnlllllfisllP 88 RleafsDgv+Ai+iT++vlelkvpe ++++a+l+ +lp++lay++sF++v+i+W+nhh+lf+++kkv++ +lw+nl+ll+++sl+P SwissProt::A0A086F3E3 5 RLEAFSDGVLAIIITIMVLELKVPE---GSSWASLQPILPRFLAYIFSFIYVGIYWNNHHHLFQTVKKVNGSILWANLHLLFWLSLMP 89 9***********************9...9**********************************************************9 PP == domain 2 score: 2.9 bits; conditional E-value: 0.0085 TMEM175 11 AiaiTllvlelkvpekeeeellaallellpell...........ayllsF 49 Aia T+l + e+e+++l +a++++++e++ +++ + SwissProt::A0A086F3E3 116 AIAYTILENVIIRCEGENSKLKEAIHSKFKEYIsiifyvlgiatSFFYPY 165 88999986655434444455555555555555433334444444444444 PP
Or compare SwissProt::A0A086F3E3 to CDD or PaperBLAST