PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001006554.1 to PF06840 (DUF1241)

NP_001006554.1 has 212 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-67  212.4   3.2    1.6e-67  212.0   3.2    1.2  1  NP_001006554.1  


Domain annotation for each sequence (and alignments):
>> NP_001006554.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.0   3.2   1.6e-67   1.6e-67       2     150 .]      15     161 ..      14     161 .. 0.98

  Alignments for each domain:
  == domain 1  score: 212.0 bits;  conditional E-value: 1.6e-67
         DUF1241   2 slvaslvlqvllrpvldklekkdvaaaqtLraalskaekesPgltqdlvkgllkkkelsvnlneslLrlqgtadteeykverseeefqeLnkkar 96 
                     ++++s++l+++++pv+++le+ +++aaqtLraa++kaeke+Pgltqd+++++l+kk+++vn++eslLr++++ d+eey++er e efq+Ln+kar
  NP_001006554.1  15 TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVDVNFTESLLRMAAD-DVEEYMIERPEPEFQDLNEKAR 108
                     5789********************************************************************.********************** PP

         DUF1241  97 aLkkiLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekeekqale 150
                     aLk+iLs+iPdeindR +fL+tIk+iAsaIk+lLd+vn+v+kk+q  ++++ale
  NP_001006554.1 109 ALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 161
                     **********************************************.8999987 PP



Or compare NP_001006554.1 to CDD or PaperBLAST