PaperBLAST – Find papers about a protein or its homologs

 

Align NP_650459.1 to PF06840 (DUF1241)

NP_650459.1 has 208 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.9e-66  207.5   0.2    5.8e-66  207.0   0.2    1.2  1  NP_650459.1  


Domain annotation for each sequence (and alignments):
>> NP_650459.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  207.0   0.2   5.8e-66   5.8e-66       5     150 .]       8     156 ..       5     156 .. 0.98

  Alignments for each domain:
  == domain 1  score: 207.0 bits;  conditional E-value: 5.8e-66
      DUF1241   5 aslvlqvllrpvldklekkdvaaaqtLraalskaekesPgltqdlvkgllkkkelsvnlneslLrlqgt...adteeykverseeefqeLnkkaraLk 99 
                  +slvl+v+lrp++++le++dv aaq+Lr+a+ k+e+++Pg+++dlv++++++++l+vnlne++Lrlqg+   ad +ey+++r+ee fqeLn+k++aLk
  NP_650459.1   8 SSLVLPVILRPIFSQLERRDVGAAQSLRSAILKSEQNNPGFCYDLVATIVRRADLNVNLNEAVLRLQGKiteADLNEYRLTRTEEPFQELNRKSVALK 105
                  799******************************************************************9999************************* PP

      DUF1241 100 kiLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekeekqale 150
                   iLsriPdeindRktfLetIkeiAsaIkklLd+vne+ ++i+  + kqa+e
  NP_650459.1 106 VILSRIPDEINDRKTFLETIKEIASAIKKLLDVVNEIGSFIPGVTGKQAVE 156
                  *************************************************97 PP



Or compare NP_650459.1 to CDD or PaperBLAST