PaperBLAST – Find papers about a protein or its homologs

 

Align NP_956849.2 to PF06840 (DUF1241)

NP_956849.2 has 210 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-67  211.3   4.3    3.7e-67  210.9   4.3    1.2  1  NP_956849.2  


Domain annotation for each sequence (and alignments):
>> NP_956849.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.9   4.3   3.7e-67   3.7e-67       3     150 .]      14     159 ..      12     159 .. 0.98

  Alignments for each domain:
  == domain 1  score: 210.9 bits;  conditional E-value: 3.7e-67
      DUF1241   3 lvaslvlqvllrpvldklekkdvaaaqtLraalskaekesPgltqdlvkgllkkkelsvnlneslLrlqgtadteeykverseeefqeLnkkaraLkk 100
                  +++s++l+++++pv+++le+ +++aaqtLraa++kaeke+Pgltqd+++++l+kk++++n++eslLr++++ d+eey+++r e+efq+Ln++araLk+
  NP_956849.2  14 SMVSMTLYAVMYPVFNELESVNLSAAQTLRAAFKKAEKENPGLTQDIIMKILEKKNVEINFTESLLRMAAD-DVEEYMIDRPEREFQDLNERARALKQ 110
                  689********************************************************************.************************** PP

      DUF1241 101 iLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekeekqale 150
                  iLs+iPdeindR +fL+tIk+iAsaIk+lLd+vn+v+kk+q  ++++ale
  NP_956849.2 111 ILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 159
                  ******************************************.8999987 PP



Or compare NP_956849.2 to CDD or PaperBLAST