PaperBLAST – Find papers about a protein or its homologs

 

Align NP_998098.1 to PF06840 (DUF1241)

NP_998098.1 has 210 amino acids

Query:       DUF1241  [M=150]
Accession:   PF06840.11
Description: Protein of unknown function (DUF1241)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.2e-67  209.6   2.2    1.2e-66  209.1   2.2    1.2  1  NP_998098.1  


Domain annotation for each sequence (and alignments):
>> NP_998098.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  209.1   2.2   1.2e-66   1.2e-66       3     150 .]      14     159 ..      12     159 .. 0.98

  Alignments for each domain:
  == domain 1  score: 209.1 bits;  conditional E-value: 1.2e-66
      DUF1241   3 lvaslvlqvllrpvldklekkdvaaaqtLraalskaekesPgltqdlvkgllkkkelsvnlneslLrlqgtadteeykverseeefqeLnkkaraLkk 100
                  +++s++l+++++pv+++l + + +aaqtLraa+ kaeke+Pgltqd+++++l+kk++++n++eslLr++++ d+eey ++r e+efq+Ln+karaLk+
  NP_998098.1  14 SIVSMTLYAVMYPVFNELGRINPSAAQTLRAAFVKAEKENPGLTQDIIMKILEKKNVEINFTESLLRMAAD-DVEEYLIKRPEQEFQDLNEKARALKH 110
                  689********************************************************************.************************** PP

      DUF1241 101 iLsriPdeindRktfLetIkeiAsaIkklLdavnevlkkiqekeekqale 150
                  iLs+iPdeindR +fL+tIk+iAsaIk+lLd+vn+v++k+q  ++++ale
  NP_998098.1 111 ILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFRKYQY-QNRRALE 159
                  ******************************************.8999987 PP



Or compare NP_998098.1 to CDD or PaperBLAST